PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.1650s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 232aa    MW: 25911.5 Da    PI: 7.5345
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.1650s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B354.81.7e-1779169197
                          EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                          ffk+  p    +s+++ +p +f+ + + + e+s++  l  + g++W++++   ++++ +++++GWk Fvk+ng+  g f++F++ g ++f
  Kalax.1650s0003.1.p  79 FFKIYFPD--DSSDIMKMPEEFVGHLKADDEGSRQAYLVGPGGEEWRMRF--ARCGNDCFFSDGWKTFVKDNGVAYGHFLLFRYRGGMRF 164
                          56666443..456779*******7778888999*****************..********************************998999 PP

                          ..EEEEE CS
                   B3  91 elvvkvf 97 
                            +v +f
  Kalax.1650s0003.1.p 165 --NVNIF 169
                          ..88877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.105.3E-2177172IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.54977172IPR003340B3 DNA binding domain
CDDcd100174.31E-1677169No hitNo description
SuperFamilySSF1019362.16E-2177172IPR015300DNA-binding pseudobarrel domain
SMARTSM010194.8E-1379172IPR003340B3 DNA binding domain
PfamPF023627.5E-1579169IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MQALLAHLIS TFNFVFFSSP FGLQPLQSVV ALHKNNKSIH CSPHPPFLHI LFLFLQIWKT  60
KTPESFGAAE FEMDLLPVFF KIYFPDDSSD IMKMPEEFVG HLKADDEGSR QAYLVGPGGE  120
EWRMRFARCG NDCFFSDGWK TFVKDNGVAY GHFLLFRYRG GMRFNVNIFT PSGLESEAAF  180
TAKCSQGWEN NGTEKGPACC LVKPSADEGT SRRPGKRPKG ESHSISFSSV S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01580.16e-13B3 family protein